PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.L6DF6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 384aa    MW: 43052.7 Da    PI: 9.6164
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.L6DF6genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like72.85e-23198242246
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehv 46 
                  pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+h+
  Araip.L6DF6 198 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHM 242
                  9*****************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.63E-8195241IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.0E-19196242IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-14198241IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPTGN GTAKQQEVDL GFWKRALDSS RTSFSSSSSP SPSSSSLPKP  60
TSYFDLSLSN PRPSPSSHYF NNTATTTPTN NHNLLFQSLQ YYHHHHHHPL LQPQPQWQPH  120
TLSQELGFLR PIRGIPVYQN PPSLPFPQHH HHHHHLLEPS SPPTTANAGA STHHFQSQAL  180
MRSRFLSRFP AKRSMRAPRM RWTTTLHARF VHAVELLGGH ERATPKSVLE LMDVKDLTLA  240
HMYRTVKTTD RAAASSGQSD VYDNRSSGDT SEDIMFDINS PSTRRSSDLS VKQGRTDNNN  300
NNNHLNQDKE YRGLWSNSSR EAWLHGKPKL DSVGNNVHSL EKEMDPKCVS YERISDGSSS  360
SNVSASTSPK KPNLDLEFTL GQPL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015963257.10.0PREDICTED: probable transcription factor KAN2
SwissprotQ9C6161e-83KAN2_ARATH; Probable transcription factor KAN2
TrEMBLV7CLW81e-149V7CLW8_PHAVU; Uncharacterized protein
STRINGGLYMA09G34030.21e-144(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59683452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.19e-70G2-like family protein